The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of 4'-Phosphopantetheinyl Transferase AcpS from Vibrio cholerae O1 biovar eltor. To be Published
    Site CSGID
    PDB Id 3h88 Target Id IDP01461
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS26798,243277, 15642453 Molecular Weight 13856.05 Da.
    Residues 126 Isoelectric Point 6.98
    Sequence mivglgtdiaeiervekalarsgenfarriltdseleqfhaskqqgrflakrfaakeaaskalgtgiaq gvtfhdftishdklgkpllilsgqaaelasqlqvenihlsisderhyamatvilerr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 24
    Resolution (Å) 1.85 Rfree 0.215
    Matthews' coefficent 2.65 Rfactor 0.174
    Waters 2281 Solvent Content 53.65

    Ligand Information
    Ligands COA (COENZYME) x 24;GOL (GLYCEROL) x 13;MRD ((4R)-2-METHYLPENTANE-2,4-DIOL) x 10;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 9;ACY (ACETIC) x 3
    Metals MG (MAGNESIUM) x 5;CL (CHLORIDE) x 1;CA (CALCIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch