.
The Open Protein Structure Annotation Network
PDB Keyword
.

3hjv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.7 Angstrom resolution crystal structure of an acyl carrier protein S-malonyltransferase from Vibrio cholerae O1 biovar eltor str. N16961. To be Published
    Site CSGID
    PDB Id 3hjv Target Id IDP01440
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS28072,243277, 15642024 Molecular Weight 33215.70 Da.
    Residues 312 Isoelectric Point 4.93
    Sequence mkerfmskfaivfpgqgsqavgmladlaeqyavvkqtfaeasevlgydlwalvqdgpvedlnqtfrtqp allaasvaiwrvwqqlgleqpavlaghslgeysalvcagvidfkqaiklvelrgqlmqqavpagtgamy aiigledeaiakacadaaqgevvspvnfnspgqvviagqkdaveragvlckeagakralplpvsvpshc almkpaadelaktlaelefnapqipvinnvdvvaetdpvkikdalirqlyspvrwtecveqmsaqgvek liemgpgkvltgltkrivktlegvavndvasldavk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.19314
    Matthews' coefficent 1.85 Rfactor 0.14521
    Waters 697 Solvent Content 33.58

    Ligand Information
    Ligands SO4 (SULFATE) x 18;CXS (3-CYCLOHEXYL-1-PROPYLSULFONIC) x 6;8JZ (BUTYL) x 1
    Metals CL (CHLORIDE) x 9

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch