The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.31 Angstrom resolution crystal structure of a holo-(acyl-carrier-protein) synthase from Bacillus anthracis str. Ames in complex with CoA (3',5'-ADP). To be Published
    Site CSGID
    PDB Id 3hyk Target Id IDP01182
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS28064,198094, 61211622 Molecular Weight 13099.43 Da.
    Residues 119 Isoelectric Point 6.84
    Sequence mivgigidiielnriekmldgklkfmeriltenernvakglkgsrltefvagrfaakeayskavgtgig kevsfldievrnddrgkpilitstehivhlsishskefavaqvvlessss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.31 Rfree 0.24654
    Matthews' coefficent 2.63 Rfactor 0.18962
    Waters 266 Solvent Content 53.19

    Ligand Information
    Ligands A3P (ADENOSINE-3'-5'-DIPHOSPHATE) x 6
    Metals MG (MAGNESIUM) x 9;CL (CHLORIDE) x 6



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch