The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Transketolase from Bacillus anthracis. To be Published
    Site CSGID
    PDB Id 3hyl Target Id IDP02454
    Related PDB Ids 3m49 
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS28084,261594, 47529034 Molecular Weight 72405.36 Da.
    Residues 666 Isoelectric Point 4.96
    Sequence mshsieqlsintirtlsidaiekansghpgmpmgaapmaytlwtqfmkhnpnnptwfnrdrfvlsaghg smllysllhlsgydvtmddlknfrqwgsktpghpeyghtagvdattgplgqgiatavgmamaerhlaak ynrdaynivdhytyaicgdgdlmegvsaeasslaahlqlgrlvvlydsndisldgdlnrsfsesvedry kaygwqvirvedgndieaiakaieeakadekrptlievrttigfgspnksgksashgsplgveetkltk eayawtaeqdfhvaeevyenfrktvqdvgetaqaewntmlgeyaqaypelanelqaamngllpegweqn lptyelgskaatrnssgavinaiaesvpsffggsadlagsnktymnnekdftrddysgkniwygvrefa mgaamngialhgglktyggtffvfsdylrpairlaalmqlpvtyvfthdsiavgedgpthepieqlaal rampnvsvirpadgnesvaawrlalestnkptalvltrqdlptlegakddtyekvakgayvvsaskket advillatgsevslaveaqkalavdgvdasvvsmpsmdrfeaqtaeykesvlpkavtkrfaiemgatfg whryvglegdvlgidtfgasapgekimeeygftvenvvrkvkeml
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.16 Rfree 0.230
    Matthews' coefficent 2.09 Rfactor 0.176
    Waters 604 Solvent Content 41.14

    Ligand Information
    Metals MG (MAGNESIUM) x 2;CL (CHLORIDE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch