The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the type III effector/phosphothreonine lyase OspF from Shigella flexneri. TO BE PUBLISHED
    Site CSGID
    PDB Id 3i0u Target Id IDP90224
    Molecular Characteristics
    Source Shigella flexneri 2a str. 301
    Alias Ids TPS31320,198214, 31983551 Molecular Weight 27826.32 Da.
    Residues 239 Isoelectric Point 7.61
    Sequence mpikkpclklnldslnvvrseipqmlsanerlknnfnilynqirqypayyfkvasnvptysdicqsfsv myqgfqivnhsgdvfihacrenpqskgdfvgdkfhisiareqvplafqilsgllfsedspidkwkitdm nrvsqqsrvgigaqftlyvksdqecsqysalllhkirqfimclesnllrskiapgeypasdvrpedwky vsyrnelrsdrdgserqeqmlreepfyrlmie
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.28726
    Matthews' coefficent 2.27 Rfactor 0.24968
    Waters 6 Solvent Content 45.90

    Ligand Information
    Ligands MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch