.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iah

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Short Chain Dehydrogenase (yciK) from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 in Complex with NADP and Acetate. TO BE PUBLISHED
    Site CSGID
    PDB Id 3iah Target Id IDP00971
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS30385,99287, 16765061 Molecular Weight 28071.55 Da.
    Residues 253 Isoelectric Point 6.96
    Sequence mhyqpkqdllqnriilvtgasdgigreaaltyarygatvillgrneeklrrvaqhiadeqhvqpqwftl dlltctaeecrqvadriaahyprldgvlhnagllgeigpmseqdpqiwqdvmqvnvnatfmltqallpl llksdagslvftsssvgrqgranwgayatskfategmmqvladeyqnrslrvncinpggtrtsmrasaf ptedpqklktpadimplylwlmgddsrrktgmtfdaqpgrkpgiaq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.83 Rfree 0.17644
    Matthews' coefficent 2.14 Rfactor 0.14327
    Waters 491 Solvent Content 42.46

    Ligand Information
    Ligands NAP (NADP) x 2;ACT (ACETATE) x 3;EOH (ETHANOL) x 2
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch