.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ib3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of SACOL2612 - CocE/NonD family hydrolase from Staphylococcus aureus. To be Published
    Site CSGID
    PDB Id 3ib3 Target Id IDP00832
    Related PDB Ids 3iii 
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS30372,93062, 57286517 Molecular Weight 64244.92 Da.
    Residues 560 Isoelectric Point 5.36
    Sequence mnqhllgnpkltvthvnevkaginhivvdsvqygnqemimekdgtvemrdgeklyinifrpnkdgkfpv vmsadtygkdnkpkitnmgalwptlgtiptssftpeespdpgfwvpndyvvvkvalrgsdkskgvlspw skreaedyyeviewaanqswsngnigtngvsylavtqwwvaslnpphlkamipweglndmyrevafhgg ipdtgfyrfwtqgifarwtdnpniedliqaqqehplfddfwkqrqvplsqiktplltcaswstqglhnr gsfegfkqaaseekwlyvhgrkewesyyarenlerqksffdfylkeenndwkdtphviyevrdqfykge fksasafplpnaeytplylnaenhtlnhakissahvaqydsedkqqdvsfkytfdkdtelvgnmnlklw vstkdsddmdlfagikkldrrgnevnfpdfnhiengqvatgwlrvshreldqekssiaqpwhkhetelk lsqdeivpveiellpsgtlfkqgetlevvvkgseivignstpgmktryeheetvnkgmhmiytggkyds qliipivn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.05 Rfree 0.24951
    Matthews' coefficent 2.22 Rfactor 0.19050
    Waters 726 Solvent Content 44.58

    Ligand Information
    Ligands PLM (PALMITIC) x 1
    Metals NI (NICKEL) x 1;CL (CHLORIDE) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch