.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ifs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.0 Angstrom Resolution Crystal Structure of Glucose-6-phosphate Isomerase (pgi) from Bacillus anthracis. To be Published
    Site CSGID
    PDB Id 3ifs Target Id IDP01650
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS30400,IDP01650, 47530435, YP_021784 Molecular Weight 50342.33 Da.
    Residues 450 Isoelectric Point 5.05
    Sequence msthvtfdyskalsfigeheitylrdavkvthhaihektgagndflgwvdlplqydkeefariqkcaek ikndsdillvvgiggsylgaraaiemlnhsfyntlskeqrktpqvlfvgqnisstymkdlmdvlegkdf sinvisksgtttepalafrifrklleekygkeearkriyattdkargalktladnegyetfvipddvgg rfsvltpvgllpiavsglnieemmkgaaagrddfgtseleenpayqyavvrnalynkgktiemlinyep alqyfaewwkqlfgesegkdqkgifpssanfstdlhslgqyvqegrrdlfetvlkvgkstheltiesee ndldglnylagetvdfvntkayegtllahsdggvpnlivnipelneytfgylvyffekacamsgyllgv npfdqpgveaykknmfallgkpgfeelkaeleerlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.00 Rfree 0.19022
    Matthews' coefficent 2.00 Rfactor 0.13996
    Waters 2418 Solvent Content 38.36

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch