.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ig4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a putative aminopeptidase P from Bacillus anthracis. To be Published
    Site CSGID
    PDB Id 3ig4 Target Id IDP01115
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS30388,198094, 30256561 Molecular Weight 48866.97 Da.
    Residues 427 Isoelectric Point 5.10
    Sequence mkskffaqnrerlvntlpdesitilfagqaphmsadahykfvpnrnfyyvtgidepnvifmlkkfgnsv eetlfieksdpvmekwvgktvsneeaekisgikkviyldsfektmsnifftenvkhlyldlecrewkgt etktlafakhvreqyphvtignvypnicelrvfktdeeieiikeaiavtkdgiynvlkhakadmmeyel eaqfdftlkssgikhhafntilasgknatvlhyedndaqiqngdlvlldlgaqkdyynadisytfpang tfssrqkqiynivlnalketteiikpglkfaalnehakkvlaegckavgliqedeelskyyyhgvshfl gldthdvgtykdrvleegmvitiepglyieeesigirieddilvtkdghenlskdiireveeieefmre nnvnvkqdevvtk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.89 Rfree 0.226
    Matthews' coefficent 3.52 Rfactor 0.198
    Waters Solvent Content 65.04

    Ligand Information
    Ligands SO4 (SULFATE) x 38
    Metals MN (MANGANESE) x 12

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch