.
The Open Protein Structure Annotation Network
PDB Keyword
.

3igj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Maltose O-acetyltransferase Complexed with Acetyl Coenzyme A from Bacillus anthracis. To be Published
    Site CSGID
    PDB Id 3igj Target Id IDP02453
    Related PDB Ids 3hjj 
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS28082,261594, 47528687 Molecular Weight 20332.06 Da.
    Residues 187 Isoelectric Point 5.56
    Sequence mktekdkmlagemyiaddeelvadrveakrltrlyneavetgderrftllnqllgssadgkaqinpdfr cdygynihvgksffanfncvildvcevrigdhcmfapgvhiytathplhpvernsgkeygkpvkignnv wvgggaiinpgvsigdnaviasgavvtkdvpnnvvvggnpakviktiee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.60 Rfree 0.213
    Matthews' coefficent 4.24 Rfactor 0.173
    Waters 176 Solvent Content 71.00

    Ligand Information
    Ligands ACO (ACETYL) x 3;SO4 (SULFATE) x 6;GOL (GLYCEROL) x 3;FMT (FORMIC) x 7
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch