.
The Open Protein Structure Annotation Network
PDB Keyword
.

3igs

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title
    Site CSGID
    PDB Id 3igs Target Id IDP01861
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS30404,99287, 16766632 Molecular Weight 24028.13 Da.
    Residues 229 Isoelectric Point 5.07
    Sequence mslleqldkniaasgglivscqpvpgspldkpeivaamalaaeqagavavriegidnlrmtrslvsvpi igiikrdldespvritpflddvdalaqagaaiiavdgtarqrpvaveallarihhhhllamadcssvdd glacqrlgadiigttmsgyttpdtpeepdlplvkalhdagcrviaegrynspalaaeairygawavtvg saitrlehicgwyndalkkaas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.177
    Matthews' coefficent 2.47 Rfactor 0.147
    Waters 910 Solvent Content 50.11

    Ligand Information
    Ligands 16G (N-ACETYL-D-GLUCOSAMINE-6-PHOSPHATE) x 1;SO4 (SULFATE) x 14
    Metals CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch