The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a Phosphocarrier Protein HPr from Bacillus anthracis str. Ames. To be Published
    Site CSGID
    PDB Id 3ihs Target Id IDP01131
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS30390,198094, 30259854 Molecular Weight 8795.67 Da.
    Residues 82 Isoelectric Point 5.70
    Sequence mvqkrvqvslknglqarpaalfvqeanrfhadifiekdgktvnaksimgimslaigtgsmitittegsd aeealealaayvq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.15 Rfree 0.18499
    Matthews' coefficent Rfactor 0.15574
    Waters 199 Solvent Content

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch