The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of 1-deoxy-D-xylulose 5-phosphate reductoisomerase from Yersinia pestis. To be Published
    Site CSGID
    PDB Id 3iie Target Id IDP00499
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS30362,214092, 16121348 Molecular Weight 43112.98 Da.
    Residues 398 Isoelectric Point 5.60
    Sequence mkqltilgstgsignstlsvvranpelfkvtalvagrnvremaqqclefspryaamsdehsakslrlll aeqgsdtevysgetaacelaalddvdqvmaaivgiaglpstlaairagkqvllankeslitcgklfmde vkrsraqllpidsehnaifqslperiqrqlgysslnengvsriiltgsggpfretplsqfsdvtpdqac ahpnwsmgrkisvdsatmmnkgleyiearwlfnasaeqievvlhpqsvihsmvryhdgsilaqmgtpdm rtpiahamaypmrvssgvapldfckvgaltfttpdyqrypclklaidacnagqaattalnaaneisvma fldskirftdievinrtvveglllseptsveevlvidrkardvaaqviaklnn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.21 Rfree 0.241
    Matthews' coefficent 2.13 Rfactor 0.179
    Waters 227 Solvent Content 42.28

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals MG (MAGNESIUM) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch