The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.05 Angstrom resolution crystal structure of a short chain dehydrogenase from Bacillus anthracis str. 'Ames Ancestor' in complex with NAD+. To be Published
    Site CSGID
    PDB Id 3ijr Target Id IDP02499
    Related PDB Ids 3i3o 
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS30426,261594, 47526031 Molecular Weight 31373.94 Da.
    Residues 288 Isoelectric Point 5.60
    Sequence mpqqknfvtmpaqhqnkqpgieslmnplpqfedpnykgseklkgknvlitggdsgigravsiafakega niaiayldeegdanetkqyvekegvkcvllpgdlsdeqhckdivqetvrqlgslnilvnnvaqqypqqg leyitaeqlektfrinifsyfhvtkaalshlkqgdviintasivayegnetlidysatkgaivaftrsl sqslvqkgirvngvapgpiwtplipssfdekkvsqfgsnvpmqrpgqpyelapayvylassdssyvtgq mihvnggvivng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.05 Rfree 0.19348
    Matthews' coefficent 2.31 Rfactor 0.15709
    Waters 936 Solvent Content 46.74

    Ligand Information
    Metals MG (MAGNESIUM) x 8



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch