.
The Open Protein Structure Annotation Network
PDB Keyword
.

3imi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.01 Angstrom resolution crystal structure of a HIT family protein from Bacillus anthracis str. 'Ames Ancestor'. To be Published
    Site CSGID
    PDB Id 3imi Target Id IDP02451
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS30424,261594, 47526323 Molecular Weight 16084.56 Da.
    Residues 144 Isoelectric Point 6.28
    Sequence mnhtadncifckiidgqilcskvyedehvlafldisqvtkghtlvipkvhkqdifaltpeiashifsvv pkianaikaefnpvgfnllnnngekagqtvfhfhlhliprygendgfgavwkshqneytmenlqniast iansvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.01 Rfree 0.19754
    Matthews' coefficent 2.28 Rfactor 0.16091
    Waters 289 Solvent Content 46.08

    Ligand Information
    Ligands SO4 (SULFATE) x 5
    Metals ZN (ZINC) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch