The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.05 Angstrom Resolution Crystal Structure of D-ribulose-phosphate 3-epimerase from Francisella tularensis. TO BE PUBLISHED
    Site CSGID
    PDB Id 3inp Target Id IDP02542
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS30429,177416, 56707900 Molecular Weight 24042.35 Da.
    Residues 222 Isoelectric Point 5.29
    Sequence mkhiqinpsilsadlarlgddvkavlaagadnihfdvmdnhyvpnltfgpmvlkalrdygitagmdvhl mvkpvdaliesfakagatsivfhpeasehidrslqliksfgiqaglalnpatgidclkyvesnidrvli msvnpgfggqkfipamldkakeiskwisstdrdilleidggvnpyniaeiavcgvnafvagsaifnsds ykqtidkmrdelnkv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.05 Rfree 0.17703
    Matthews' coefficent 4.37 Rfactor 0.15833
    Waters 172 Solvent Content 71.86

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals CL (CHLORIDE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch