.
The Open Protein Structure Annotation Network
PDB Keyword
.

3iq1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of DPS protein from Vibrio cholerae O1, a member of a broad superfamily of ferritin-like diiron-carboxylate proteins. TO BE PUBLISHED
    Site CSGID
    PDB Id 3iq1 Target Id IDP01318
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS30392,243277, 15640170 Molecular Weight 17872.35 Da.
    Residues 156 Isoelectric Point 5.15
    Sequence matnligldttqsqklanalnnllanyqvfymntrgyhwniqgkeffelhakfeeiytdlqlkidelae riltlsarpmhsfsgylkaaqikehtdsidgrssmqglvdgfsillhqqrdilelagetgdegtsalms dyireqeklvwmlnawlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.67 Rfree 0.17381
    Matthews' coefficent 2.59 Rfactor 0.13936
    Waters 777 Solvent Content 52.49

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch