.
The Open Protein Structure Annotation Network
PDB Keyword
.

3irc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure Analysis of the Dengue-1 Envelope Protein Domain III. To be Published
    Site CSGID
    PDB Id 3irc Target Id IDP00272
    Related PDB Ids 3egp 
    Molecular Characteristics
    Source Dengue virus 1
    Alias Ids TPS24729,11053, 7329982 Molecular Weight 53910.39 Da.
    Residues 495 Isoelectric Point 7.89
    Sequence mrcvgignrdfveglsgatwvdvvlehgscvttmaknkptldiellktevtnpavlrklcieakisntt tdsrcptqgeatlveeqdanfvcrrtfvdrgwgngcglfgkgslitcakfkcvtklegkivqyenlkys vivtvhtgdqhqvgnettehgttatitpqaptseiqltdygtltldcsprtgldfnemvlltmkerswl vhkqwfldlplpwtsgastsqetwnrqdllvtfktahakkqevvvlgsqegamhtaltgateiqtsgtt tifaghlkcrlkmdkltlkgmsyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekga tqngrlitanpivtdkekpvnieaeppfgesyivvgagekalklswfkkgssigkmfeatargarrmai lgdtawdfgsiggvftsmgklvhqvfgtaygvlfsgvswtmkigigilltwlglnsrntslsmmciavg mvtlylgvmvqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.25 Rfree 0.22144
    Matthews' coefficent 5.08 Rfactor 0.21145
    Waters 53 Solvent Content 75.77

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch