The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of 3-deoxy-manno-octulosonate cytidylyltransferase from Yersinia pestis. To be Published
    Site CSGID
    PDB Id 3jtj Target Id IDP02355
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS30422,214092, 16121680 Molecular Weight 27334.86 Da.
    Residues 250 Isoelectric Point 5.40
    Sequence msfiaiiparyastrlpgkpladiagkpmvvhvmeralasgadrvivatdhpdvvkaveaaggevcltr adhqsgterlaeviehygfadddiivnvqgdeplvppviirqvadnlaacsagmatlavpiasseeafn pnavkvvmdaqgyalyfsratipwererfaqsketigdcflrhigiyayragfirryvnwapsqleqie lleqlrvlwygekihvavakavpavgvdtqsdldrvraimlnq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.18 Rfree 0.209
    Matthews' coefficent 4.56 Rfactor 0.182
    Waters 112 Solvent Content 73.02

    Ligand Information
    Ligands IMD (IMIDAZOLE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch