.
The Open Protein Structure Annotation Network
PDB Keyword
.

3jze

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.8 Angstrom Resolution Crystal Structure of Dihydroorotase (pyrC) from Salmonella enterica subsp. enterica serovar Typhimurium str. LT2. TO BE PUBLISHED
    Site CSGID
    PDB Id 3jze Target Id IDP00873
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS30382,99287, 16764519 Molecular Weight 38603.03 Da.
    Residues 348 Isoelectric Point 5.85
    Sequence mtapsqvlkirrpddwhvhlrdgdmlktvvpytseiygraivmpnlaspittvdaaiayrqrildavpa ghdftplmtcyltdsldadelergfhegvftaaklypanattnsshgvtsvdaimpvlermeklgipll vhgevthadvdifdrearfidtvmeplrqrltalkvvfehittkdaaqyvrdgndylaatitpqhlmfn rndmlvggirphlyclpilkrnihqqalrelvasgftraflgtdsaphsrhrketscgcagcfnapsal gsyaavfeemnalahfeafcslngpqfyglpmntgwvelvrdeqqipgnialaddslvpflagetvrwsvkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.20301
    Matthews' coefficent 2.18 Rfactor 0.16347
    Waters 1350 Solvent Content 43.69

    Ligand Information
    Ligands BME (BETA-MERCAPTOETHANOL) x 8;PGE (TRIETHYLENE) x 2;ACY (ACETIC) x 6;PG4 (TETRAETHYLENE) x 2
    Metals ZN (ZINC) x 8;CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch