.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k1s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the PTS Cellobiose Specific Enzyme IIA from Bacillus anthracis. To be Published
    Site CSGID
    PDB Id 3k1s Target Id IDP01100
    Molecular Characteristics
    Source Bacillus anthracis str. ames
    Alias Ids TPS31250,198094, 30259910 Molecular Weight 11946.09 Da.
    Residues 107 Isoelectric Point 5.20
    Sequence mmttaeqipfqlilnsgnarsfamealqfakqgkmaeadeamvkakeaineahhfqteliqseargekt eisvllihaqdhlmnaitvkelaaefidlykkleakge
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 9
    Resolution (Å) 2.30 Rfree 0.226
    Matthews' coefficent 2.52 Rfactor 0.185
    Waters 621 Solvent Content 51.22

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 14;CL (CHLORIDE) x 3;MG (MAGNESIUM) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch