The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure and protein-protein interaction studies on Chlamydia trachomatis protein CT670 (YscO Homolog). J.Bacteriol. 192 2746-2756 2010
    Site CSGID
    PDB Id 3k29 Target Id IDP90225
    Molecular Characteristics
    Source Chlamydia trachomatis d/uw-3/cx
    Alias Ids TPS31321,272561, 3329121 Molecular Weight 20286.23 Da.
    Residues 168 Isoelectric Point 7.84
    Sequence mvryplepvlsikkdrvdraekvvkekrrlleleqeklrereserdkvknhymqkirqlreqlddgtts dailkmkayikvvaiqlseeeekvnkqkenvlaaskeleraeveltkrrkeeektrlhkeewmkealke earqeekeqdemgqllhqlhkqkqresgen
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.285
    Matthews' coefficent 2.35 Rfactor 0.240
    Waters 51 Solvent Content 47.75

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch