.
The Open Protein Structure Annotation Network
PDB Keyword
.

3k96

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.1 Angstrom Resolution Crystal Structure of Glycerol-3-phosphate Dehydrogenase (gpsA) from Coxiella burnetii. TO BE PUBLISHED
    Site CSGID
    PDB Id 3k96 Target Id IDP01976
    Molecular Characteristics
    Source Coxiella burnetii rsa 493
    Alias Ids TPS31302,227377, 29542077 Molecular Weight 36065.49 Da.
    Residues 332 Isoelectric Point 6.52
    Sequence mepfkhpiailgagswgtalalvlarkgqkvrlwsyesdhvdemqaegvnnrylpnypfpetlkaycdl kaslegvtdilivvpsfafhevitrmkplidaktriawgtkglakgsrllhevvatelgqvpmavisgp slatevaanlptavslasnnsqfskdlierlhgqrfrvyknddmigvelcgsvknilaiatgisdglkl gsnaraalitrgltemgrlvsvfggkqetltglaglgdlvltctdnqsrnrrfglalgegvdkkeaqqa igqaieglyntdqvhalaqkhaiempltfqvhrilhedldpqqavqellerspkae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.21037
    Matthews' coefficent 2.36 Rfactor 0.16422
    Waters 493 Solvent Content 47.90

    Ligand Information
    Ligands EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 2;BME (BETA-MERCAPTOETHANOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch