.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kd3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a phosphoserine phosphohydrolase-like protein from Francisella tularensis subsp. tularensis SCHUS4. TO BE PUBLISHED
    Site CSGID
    PDB Id 3kd3 Target Id IDP02448
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS31307,177416, 56707697 Molecular Weight 24413.61 Da.
    Residues 216 Isoelectric Point 5.03
    Sequence mkniifdfdstlikkeslelilepilqkspaklkeieyitnlgmqgdisfrdslqkrlaiasptkqsik efsnkycpnlltdgikelvqdlknkgfeiwifsgglsesiqpfadylniprenifavetiwnsdgsfke ldnsngacdsklsafdkakglidgeviaigdgytdyqlyekgyatkfiaymehierekvinlskyvarn vaelaslim
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.18603
    Matthews' coefficent 2.52 Rfactor 0.16305
    Waters 327 Solvent Content 51.26

    Ligand Information
    Ligands GOL (GLYCEROL) x 3
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch