.
The Open Protein Structure Annotation Network
PDB Keyword
.

3khy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a propionate kinase from Francisella tularensis subsp. tularensis SCHU S4. To be Published
    Site CSGID
    PDB Id 3khy Target Id IDP01739
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS31293,177416, 56708751 Molecular Weight 42189.42 Da.
    Residues 384 Isoelectric Point 7.69
    Sequence mseilvlncgsssvkfalinphtsqslvtglaeniatknckvvfkaehkivkylengsykdvfemlkdf lvenkhlekivaighrvvhggqyfsksvlinadslekikacialaplhnpahiegirfcqqifpelpqv avfdtafhqtmpsyiaeyaipyelthkhnirkygahgtshkyvseqaakiltqqkanvivahlgngcsi tavvdgksidtsmgltpldglvmgtrsgcidpsifayisdnlgwsvteitnmlnkqsgllgicghndmr evsqlaakgdslaklaieifshrvakfvasymiyfnkldalvftggigenaanirkniisklanlgfmi dhqknsnsetfinsknshnimviatneelmiaqetqnli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.98 Rfree 0.1933
    Matthews' coefficent 2.56 Rfactor 0.1553
    Waters 660 Solvent Content 51.90

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch