.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kom

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of apo transketolase from Francisella tularensis. TO BE PUBLISHED
    Site CSGID
    PDB Id 3kom Target Id IDP02310
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS31305,177416, 56708422 Molecular Weight 73317.56 Da.
    Residues 663 Isoelectric Point 5.88
    Sequence mslsiprefsnairflsidatlkaksghpgmpmgmadiatvlwtkflkhnpnnphwinrdrfvlsnghg smllysllhltgydlsiediknfrqlhsktpghpeygytpgvetttgplgqgvanavgmalgekllsdr yntpdlkvidhhtyvflgdgclmegvsheacslagtlglnklvafwddnnisidgdtkgwfsdntperf raygwhvienvdghdfvaiekaineahsqqqkptliccktvigfgspekagtasvhgsplsdqerasaa kelnwdyqafeipqdvykywdarekgqaleanwqgqwnlfkdspkfdefervlskelpvglesaindyi asqlsnpvkvatrkasqmvlevlcknmpemfggsadltgsnntnwsgsvwlnntqeganylsygvrefg maaimnglslyggikpyggtflvfsdysrnairmsalmkqpvvhvmshdsiglgedgpthqpiehvpsl rlipnlsvwrpadtietmiawkeavkskdtpsvmvltrqnlmpvvqtqhqvaniarggylvkdnpdakl tivatgsevelavkvanefekkgiklnvasipcvevfatqaheykktvikddipavfvemaqpdmwyky mpkaggevkgiysfgesapaedlfkrfgftvenisnivakyv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.199
    Matthews' coefficent 2.04 Rfactor 0.163
    Waters 1336 Solvent Content 39.76

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch