.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kuu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the PurE Phosphoribosylaminoimidazole Carboxylase Catalytic Subunit from Yersinia pestis. To be Published
    Site CSGID
    PDB Id 3kuu Target Id IDP02536
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS31316,214092, 16123253 Molecular Weight 17950.51 Da.
    Residues 174 Isoelectric Point 5.57
    Sequence mganlnsayaagvkiaivmgsksdwatmqfaadvlttlnvpfhvevvsahrtpdrlfsfaeqaeanglh viiagaggaahlpgmlaaktlvpvlgvpvqsaalsgvdslysivqmprgipvgtlaigkagaanaalla aqilalhdtelagrlahwrqsqtddvldnpdpreea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.41 Rfree 0.167
    Matthews' coefficent 2.58 Rfactor 0.150
    Waters 908 Solvent Content 52.34

    Ligand Information
    Ligands SO4 (SULFATE) x 14
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch