.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kwo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Bacterioferritin from Campylobacter jejuni. To be Published
    Site CSGID
    PDB Id 3kwo Target Id IDP01964
    Molecular Characteristics
    Source Campylobacter jejuni subsp. jejuni nctc 11168
    Alias Ids TPS31297,192222, 218563127 Molecular Weight 17203.95 Da.
    Residues 149 Isoelectric Point 5.56
    Sequence msvtkqllqmqadahhlwvkfhnyhwnvkglqffsiheytekayeemaelfdscaervlqlgekaitcq kvlmenakspkvakdcftplevielikqdyeyllaefkklneaaekesdtttaafaqeniakyekslwm igatlqgackm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.99 Rfree 0.1965
    Matthews' coefficent 2.34 Rfactor 0.1436
    Waters 573 Solvent Content 47.42

    Ligand Information
    Ligands ACY (ACETIC) x 24;GOL (GLYCEROL) x 2;BU1 (1,4-BUTANEDIOL) x 3
    Metals ZN (ZINC) x 26

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch