The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.35 Angstrom resolution crystal structure of a putative tRNA (guanine-7-)-methyltransferase (trmD) from Staphylococcus aureus subsp. aureus MRSA252. To be Published
    Site CSGID
    PDB Id 3ky7 Target Id IDP90258
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mrsa252
    Alias Ids TPS31322,282458, 49483403 Molecular Weight 28024.48 Da.
    Residues 245 Isoelectric Point 5.47
    Sequence mkidyltlfpemfdgvlnhsimkraqennklqintvnfrdyainkhnqvddypygggqgmvlkpepvfn amedldvteqarvilmcpqgepfshqkavelskadhivficghyegyderirthlvtdeismgdyvltg gelpamtmtdaivrlipgvlgneqshqddsfsdgllefpqytrprefkgltvpdvllsgnhanidawrh eqklirtynkrpdliekypltnadkqilerykiglkkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.35 Rfree 0.25535
    Matthews' coefficent 2.65 Rfactor 0.20855
    Waters 86 Solvent Content 53.56

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch