The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Carboxyvinyl-Carboxyphosphonate Phosphorylmutase from Bacillus anthracis str. Ames Ancestor. To be Published
    Site CSGID
    PDB Id 3kz2 Target Id IDP02080
    Related PDB Ids 3ih1 
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS30412,261594, 47527645 Molecular Weight 33013.73 Da.
    Residues 302 Isoelectric Point 4.85
    Sequence mawvvnkqstqeelanrfralveaneilqipgahdamaalvarntgflalylsgaaytaskglpdlgiv tstevaerardlvratdlpvlvdidtgfggvlnvartavemveakvaavqiedqqlpkkcghlngkklv tteelvqkikaikevapslyivartdargvegldeaieranayvkagadaifpealqseeefrlfnskv napllanmtefgktpyysaeefanmgfqmviypvtslrvaakayenvftliketgsqkdalsnmqtrse lyetisyhdfeeldtgiaktvlsedq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.50 Rfree 0.169
    Matthews' coefficent 2.74 Rfactor 0.1470
    Waters 147 Solvent Content 55.15

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch