.
The Open Protein Structure Annotation Network
PDB Keyword
.

3kzw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title
    Site CSGID
    PDB Id 3kzw Target Id IDP00662
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus col
    Alias Ids TPS48381,93062, 57285819 Molecular Weight 54125.78 Da.
    Residues 491 Isoelectric Point 5.53
    Sequence mnfklnntlsneintliigipehlnqlerisfnhiditeslerlkhqhiigskvgkiyttafdvqdqty rlitvglgnlktrsyqdmlkiwghlfqyiksehiedtyllmdsfiskydqlsdvlmacgiqseratyef dhyksskkapfktnlnliseslieldfihegisigqsinlardfsnmppnvltpqtfaedivnhfkntk vkvdvkdydtlvsegfgllqavgkgskhkprlvtityngkdkdeapialvgkgitydsggysiktkngm atmkfdmcgaanvvgiieaasrlqlpvnivgvlacaenmineasmkpddvftalsgetvevmntdaegr lvladavfyanqyqpsvimdfatltgaaivalgddkaaafesnskvilndilqissevdemvfelpita terasikhsdiadlvnhtngqgkalfaasfvthfsgqtphihfdiagpattnkasyngpkgptgfmipt ivqwlkqq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.70 Rfree 0.24020
    Matthews' coefficent 2.76 Rfactor 0.22139
    Waters 698 Solvent Content 55.45

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 4
    Metals NA (SODIUM) x 19;CL (CHLORIDE) x 67

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch