The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase, putative bifunctional protein folD from Francisella tularensis. To be Published
    Site CSGID
    PDB Id 3l07 Target Id IDP01849
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS31296,177416, 56707993 Molecular Weight 30452.64 Da.
    Residues 282 Isoelectric Point 6.75
    Sequence milidgkslskdlkerlatqvqeykhhtaitpklvaiivgndpasktyvaskekacaqvgidsqvitlp ehttesellelidqlnndssvhailvqlplpahinknnviysikpekdvdgfhptnvgrlqlrdkkcle sctpkgimtmlreygiktegayavvvgasnvvgkpvsqlllnakatvttchrfttdlkshttkadiliv avgkpnfitadmvkegavvidvginhvdgkivgdvdfaavkdkvaaitpvpggvgpmtitellyntfqc aqelnr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.88 Rfree 0.208
    Matthews' coefficent 2.24 Rfactor 0.165
    Waters 437 Solvent Content 45.11

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;IMD (IMIDAZOLE) x 2;EDO (1,2-ETHANEDIOL) x 4;ACT (ACETATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch