.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lac

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Bacillus anthracis pyrrolidone-carboxylate peptidase, pcP. To be Published
    Site CSGID
    PDB Id 3lac Target Id IDP02531
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS31315,261594, 50196941 Molecular Weight 23511.73 Da.
    Residues 215 Isoelectric Point 5.07
    Sequence mktvlltgfdpfggesinpawevakslhektigeykiiskqvptvfhksisvlkeyieelapefiicig qaggrpditiervainiddariadnegnqpvdvpvveegpaaywstlpmkaivkklqeegipasvsqta gtfvcnhlfyglmhelekhdtkmkggfihipflpeqasnypgqpsmslstirkgielavevtttvevdi vevggtth
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.223
    Matthews' coefficent 2.29 Rfactor 0.181
    Waters 290 Solvent Content 46.20

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 9
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch