The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Dihydrodipicolinate Synthase from Campylobacter jejuni subsp. jejuni NCTC 11168. To be Published
    Site CSGID
    PDB Id 3ler Target Id IDP90711
    Related PDB Ids 3m5v 
    Molecular Characteristics
    Source Campylobacter jejuni subsp. jejuni nctc 11168
    Alias Ids TPS31327,192222, 15792144 Molecular Weight 32668.91 Da.
    Residues 298 Isoelectric Point 6.02
    Sequence mdkniiigamtalitpfkngkvdeqsyarlikrqiengidavvpvgttgesatltheehrtcieiavet ckgtkvkvlagagsnatheavglakfakehgadgilsvapyynkptqqglyehykaiaqsvdipvllyn vpgrtgceistdtiiklfrdceniygvkeasgnidkcvdllaheprmmlisgedainypilsnggkgvi svtsnllpdmisalthfaldenykeakkindelyninkilfcesnpipiktamylaglieslefrlplc spskenfakieevmkkykikgf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.84 Rfree 0.1903
    Matthews' coefficent 2.30 Rfactor 0.1520
    Waters 1100 Solvent Content 46.43

    Ligand Information
    Metals MG (MAGNESIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch