.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lg3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.4A Crystal Structure of Isocitrate Lyase from Yersinia pestis CO92. To be Published
    Site CSGID
    PDB Id 3lg3 Target Id IDP02638
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS48427,214092, 16123862 Molecular Weight 47669.20 Da.
    Residues 435 Isoelectric Point 5.47
    Sequence mtisrtqqiqqleqewtsprwknitrpysaedviklrgsvnpectfaqngakklwellhggsrkgyinc lgaltggqalqqakagveaiymsgwqvaadantassmypdqslypvdsvpavvkrinnsfrradqiqws nniepgskgytdyflpivadaeagfggvlnafelmkamieagaagvhfedqlaavkkcghmggkvlvpt qeaiqklvaarlaadvlgvptlliartdadaadlltsdcdpydrefitgdrtaegffrtragieqaisr glayapyadlvwcetstpdlalakrfadavhaqfpgkllayncspsfnwkknltdqqiasfqdelsamg ykyqfitlagihsmwfnmfdlahayaqgegmkhyvekvqqpefasvdrgytfashqqevgtgyfdkvtn iiqggassvtaltgsteeqqf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.1653
    Matthews' coefficent 2.46 Rfactor 0.1311
    Waters 1175 Solvent Content 49.97

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch