.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lhq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of DNA-binding transcriptional repressor AcrR from Salmonella typhimurium. To be Published
    Site CSGID
    PDB Id 3lhq Target Id IDP02616
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS31317,99287, 16763857 Molecular Weight 24901.53 Da.
    Residues 217 Isoelectric Point 6.24
    Sequence marktkqqaletrqhildvalrlfsqqgvsatslaeianaagvtrgaiywhfknksdlfseiwelsesn igeleieyqakfpddplsvlreilvhileatvteerrrllmeiifhkcefvgemvvvqqaqrslclesy drieqtlkhcinakmlpenlltrraailmrsfisglmenwlfapqsfdlkkearayvtillemyqlcpt lrastvngsp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.56 Rfree 0.199
    Matthews' coefficent 1.85 Rfactor 0.150
    Waters 281 Solvent Content 33.68

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 2;EDO (1,2-ETHANEDIOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch