.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lqn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of CBS Domain-containing Protein of Unknown Function from Bacillus anthracis str. Ames Ancestor. To be Published
    Site CSGID
    PDB Id 3lqn Target Id IDP02609
    Molecular Characteristics
    Source Bacillus anthracis str. ames ancestor
    Alias Ids TPS48420,261594, 47529491 Molecular Weight 16757.91 Da.
    Residues 147 Isoelectric Point 5.95
    Sequence misipkdefqqifvkdlmissekvahvqignglehallvlvksgysaipvldpmyklhglistamildg ilglerieferleemkveqvmkqdipvlkledsfakalemtidhpficavnedgyfegiltrrailkll nkkvrqhnr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.2376
    Matthews' coefficent 1.95 Rfactor 0.1839
    Waters 103 Solvent Content 37.06

    Ligand Information
    Ligands SO4 (SULFATE) x 6;FMT (FORMIC) x 4;GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch