.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lus

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a putative organic hydroperoxide resistance protein with molecule of captopril bound in one of the active sites from Vibrio cholerae O1 biovar eltor str. N16961. TO BE PUBLISHED
    Site CSGID
    PDB Id 3lus Target Id IDP01325
    Related PDB Ids 3eer 3i07 
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS24737,243277, 15601759 Molecular Weight 15056.23 Da.
    Residues 145 Isoelectric Point 6.27
    Sequence mrnknmstiyqtsatasagrngvvstedkllelnlsypkemggsgtatnpeqlfavgyaacfsnailhv areakvalkeapvtatvgigpngqggfalsvalaahialedeqarqlvtvahqvcpysnavrgnidvqv svnglal
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.96 Rfree 0.22697
    Matthews' coefficent 1.87 Rfactor 0.17080
    Waters 90 Solvent Content 34.08

    Ligand Information
    Ligands MCO (1-(3-MERCAPTO-2-METHYL-PROPIONYL)-PYRROLIDINE-2-) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch