.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lv8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.8 Angstrom resolution crystal structure of a thymidylate kinase (tmk) from Vibrio cholerae O1 biovar eltor str. N16961 in complex with TMP, thymidine-5'-diphosphate and ADP. To be Published
    Site CSGID
    PDB Id 3lv8 Target Id IDP90611
    Related PDB Ids 3n2i 
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS48453,243277, 15642018 Molecular Weight 23664.64 Da.
    Residues 212 Isoelectric Point 5.04
    Sequence mnakfivieglegagkstaiqvvvetlqqngidhitrtrepggtllaeklralvkeehpgeelqditel llvyaarvqlvenvikpalargewvvgdrhdmssqayqgggrqiapstmqslkqtalgdfkpdltlyld idpklglerargrgeldriekmdisfferarerylelansddsvvmidaaqsieqvtadirralqdwls qvnrv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.20393
    Matthews' coefficent 2.27 Rfactor 0.16410
    Waters 291 Solvent Content 45.87

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 1;TMP-TYD (THYMIDINE-5'-PHOSPHATE) x 1
    Metals CL (CHLORIDE) x 1;CA (CALCIUM) x 6

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch