.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lyl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of 3-oxoacyl-acylcarrier protein reductase, FabG from Francisella tularensis. TO BE PUBLISHED
    Site CSGID
    PDB Id 3lyl Target Id IDP00334
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS48374,177416, 56708428 Molecular Weight 26355.79 Da.
    Residues 247 Isoelectric Point 8.46
    Sequence mslnekvalvtgasrgigfevahalaskgatvvgtatsqasaekfensmkekgfkarglvlnisdiesi qnffaeikaenlaidilvnnagitrdnlmmrmsedewqsvintnlssifrmskecvrgmmkkrwgriis igsvvgsagnpgqtnycaakagvigfskslayevasrnitvnvvapgfiatdmtdkltdeqksfiatki psgqigepkdiaaavaflaseeakyitgqtlhvnggmyma
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.95 Rfree 0.243
    Matthews' coefficent 2.22 Rfactor 0.199
    Waters 804 Solvent Content 44.69

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch