.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m07

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.4 Angstrom Resolution Crystal Structure of Putative alpha Amylase from Salmonella typhimurium. TO BE PUBLISHED
    Site CSGID
    PDB Id 3m07 Target Id IDP00968
    Molecular Characteristics
    Source Salmonella enterica subsp. enterica serovar typhimurium str. lt2
    Alias Ids TPS48387,99287, 16764904 Molecular Weight 65770.47 Da.
    Residues 594 Isoelectric Point 5.31
    Sequence msskifckswgaeyiaadvvrfrlwatgqqkvmlrlagkdqemqangdgwftldvagvtpgteynfvls dgmvvpdpasraqktdvngpsyvvdpgsytwrntgwkgsrweqavvyemhtgtftpegtfraaiaklpy laelgvtvievmpvaqfggergwgydgvllyaphsaygtpddfkafidaahgyglsvvldivlnhfgpe gnylpllapaffhkermtpwgngiaydvdavrryiieaplywlteyhldglrfdaidqiedssarhvlv eiaqrireditdrpihlttedsrniislhprdqdgnaplftaewnddfhnavhvfatgetqayyndfad apekhlaralaegfayqgeispqtgeprgvkstgqppvafvdfiqnhdqvgnraqgdrlitlagaertk vllatlllsphipllfmgeeygesrpflfftdfhgdlaravregrakefadhagenvpdpnapetfqrs klnwkqqhseegkawlaftrellllrqkhivpllsaaressgtvlqtapgfiavswrfpggtlslalni sattvllpdlpgktlfawpnestgslsqhslivrlaqgesas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.17265
    Matthews' coefficent 1.83 Rfactor 0.14789
    Waters 661 Solvent Content 32.73

    Ligand Information
    Ligands BTB (2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-) x 1;PG4 (TETRAETHYLENE) x 2;PGE (TRIETHYLENE) x 1
    Metals MG (MAGNESIUM) x 6;CL (CHLORIDE) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch