.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m5u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Phosphoserine Aminotransferase from Campylobacter jejuni. To be Published
    Site CSGID
    PDB Id 3m5u Target Id IDP90849
    Molecular Characteristics
    Source Campylobacter jejuni subsp. jejuni nctc 11168
    Alias Ids TPS48472,192222, 15791694 Molecular Weight 40484.14 Da.
    Residues 358 Isoelectric Point 6.41
    Sequence mrkinfsagpstlpleileqaqkelcdyqgrgysimeishrtkvfeevhfgaqekakklyelnddyevl flqggaslqfamipmnlalngvceyantgvwtkkaikeaqilgvnvktvasseesnfdhiprvefsdna dyayicsnntiygtqyqnypktktplivdassdffsrkvdfsnialfyggvqknagisglscifirkdm lersknkqipsmlnylthaenqslfntpptfaiymfnlemdwllnqggldkvheknsqkatmlyecidl sngfykghadkkdrslmnvsfniaknkdleplfvkeaeeagmiglkghrilggirasiynalnldqvkt lcefmkefqgkya
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.15 Rfree 0.220
    Matthews' coefficent 2.42 Rfactor 0.169
    Waters 428 Solvent Content 49.17

    Ligand Information
    Ligands GOL (GLYCEROL) x 1;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch