.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m7i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of transketolase in complex with thiamine diphosphate, ribose-5-phosphate(pyranose form) and magnesium ion. TO BE PUBLISHED
    Site CSGID
    PDB Id 3m7i Target Id IDP90564
    Related PDB Ids 3l84 3m34 3m6l 
    Molecular Characteristics
    Source Campylobacter jejuni subsp. jejuni nctc 11168
    Alias Ids TPS31325,192222, 15792950 Molecular Weight 69632.66 Da.
    Residues 632 Isoelectric Point 6.05
    Sequence mniqilqeqantlrflsadmvqkansghpgaplgladilsvlsyhlkhnpknptwlnrdrlvfsgghas allysflhlsgydlsledlknfrqlhsktpghpeistlgveiatgplgqgvanavgfamaakkaqnllg sdlidhkiyclcgdgdlqegisyeacslaglhkldnfiliydsnnisiegdvglafnenvkmrfeaqgf evlsinghdyeeinkaleqakkstkpcliiakttiakgagelegshkshgaplgeevikkakeqagfdp nisfhipqaskirfesavelgdleeakwkdkleksakkellerllnpdfnkiaypdfkgkdlatrdsng eilnvlaknlegflggsadlgpsnktelhsmgdfvegknihfgirehamaainnafarygiflpfsatf fifseylkpaariaalmkikhffifthdsigvgedgpthqpieqlstframpnfltfrpadgvenvkaw qialnadipsafvlsrqklkalnepvfgdvkngayllkeskeakftllasgsevwlclesanelekqgf acnvvsmpcfelfekqdkayqerllkgevigveaahsnelykfchkvygiesfgesgkdkdvferfgfs vsklvnfilsk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.21076
    Matthews' coefficent 2.14 Rfactor 0.16711
    Waters 328 Solvent Content 42.59

    Ligand Information
    Ligands TPP (THIAMINE) x 1;EDO (1,2-ETHANEDIOL) x 1;RP5 (RIBOSE-5-PHOSPHATE,) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch