.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m84

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Phosphoribosylaminoimidazole Synthetase from Francisella tularensis. To be Published
    Site CSGID
    PDB Id 3m84 Target Id IDP04643
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS48439,177416, 56707994 Molecular Weight 37777.34 Da.
    Residues 347 Isoelectric Point 5.24
    Sequence maglkyedagvnieagnqavermkqhvkktftqdvltglgsfgslyslkniinnyddpvlvqsidgvgt ktkvavmcgkfenlgydlfsaatndivvmgakpitfldyvahdkldpaimeelvkgmskacaecgvslv ggetaempgvyqageidmvgvitgivdrkriingenikegdivfglsssglhtngysfarklffdvagn khtdtypelegktigdvllephinytniihdfldngvdikgmahitgggfieniprvlpqglgaqidkd sfatpaifklmqrigdisefemyrsfnmgigmtiiasqdqfdkmqelakkhtntklyqigkitnsgkveii
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.183
    Matthews' coefficent 2.18 Rfactor 0.154
    Waters 816 Solvent Content 43.57

    Ligand Information
    Ligands SO4 (SULFATE) x 14;AMP (ADENOSINE) x 1;ACY (ACETIC) x 3;FMT (FORMIC) x 2;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch