.
The Open Protein Structure Annotation Network
PDB Keyword
.

3msu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Citrate Synthase from Francisella tularensis. To be Published
    Site CSGID
    PDB Id 3msu Target Id IDP04634
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS48438,177416, 56707250 Molecular Weight 47395.82 Da.
    Residues 424 Isoelectric Point 6.12
    Sequence mevmlmskyatlkyadknieielpvyspslgndcidvsslvkhgiftydpgfmstaaceskityidggk gvllhrgypieewtqksnyrtlcyaliygelptdeqvksfrqeiinkmpvcehvkaaiaampqhthpms sliagvnvlaaehihngqkesqdevaknivakiatiaamayrhnhgkkflepkmeygyaenflymmfad desykpdelhikamdtifmlhadheqnaststvrlsgstgnspyaaiiagitalwgpahgganeavlkm lseigstenidkyiakakdkddpfrlmgfghrvykntdpratamkknceeilaklghsdnplltvakkl eeialqdeffierklfsnvdfysgiilkamgipedmftaifalartsgwisqwiemvndpaqkigrprq lytgatnrnf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.84 Rfree 0.200
    Matthews' coefficent 2.32 Rfactor 0.16
    Waters 580 Solvent Content 47.09

    Ligand Information
    Ligands OAA (OXALOACETATE) x 2;SO4 (SULFATE) x 3;ACY (ACETIC) x 1;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 1
    Metals ZN (ZINC) x 2;CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch