.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mxt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Pantoate-Beta-alanine Ligase from Campylobacter jejuni. To be Published
    Site CSGID
    PDB Id 3mxt Target Id IDP90800
    Molecular Characteristics
    Source Campylobacter jejuni subsp. jejuni nctc 11168
    Alias Ids TPS48469,192222, 15791665 Molecular Weight 32085.62 Da.
    Residues 282 Isoelectric Point 6.60
    Sequence mqvitsvkeakqivkdwkshqlsigyvptmgflhdghlslvkhaktqdkvivsifvnpmqfgpnedfss yprdlerdikmcqdngvdmvfipdatqmylknfstyvdmntitdklcgakrpghfrgvctvltkffnil npdivymgqkdaqqcvvvrhmvddlnfdlkiqicpiireedglakssrnvylskeerkaslaisqsifl aeklvregekntskiiqamkdilekeklikidyielvdfntmenienitdnvlgavaafvgktrlidnf lvqglk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.198
    Matthews' coefficent 2.26 Rfactor 0.159
    Waters 365 Solvent Content 45.64

    Ligand Information
    Ligands GOL (GLYCEROL) x 2;SO4 (SULFATE) x 1;FMT (FORMIC) x 3
    Metals MG (MAGNESIUM) x 1;CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch