.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n2l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 2.1 Angstrom resolution crystal structure of an Orotate Phosphoribosyltransferase (pyrE) from Vibrio cholerae O1 biovar eltor str. N16961. To be Published
    Site CSGID
    PDB Id 3n2l Target Id IDP90785
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar el tor str. n16961
    Alias Ids TPS48466,243277, 15640241 Molecular Weight 23531.54 Da.
    Residues 214 Isoelectric Point 5.46
    Sequence mmkayqrefiefalekqvlkfgeftlksgrkspyffnaglfntgrdlarlgrfyaaalvdsgiefdvlf gpaykgipiatttavaladhhdvdtpycfnrkeaknhgeggnlvgsklegrvmlvddvitagtairesm eliqankadlagvlvaidrqekgkgelsaiqeverdfgcavisivsltdlityleqqgnntehleavka yraqygi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.26861
    Matthews' coefficent 2.36 Rfactor 0.22200
    Waters 648 Solvent Content 47.78

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch