.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n8h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Pantoate-beta-alanine Ligase from Francisella tularensis. To be Published 2010
    Site CSGID
    PDB Id 3n8h Target Id IDP02771
    Molecular Characteristics
    Source Francisella tularensis subsp. tularensis schu s4
    Alias Ids TPS48429,177416, 56708439 Molecular Weight 29713.85 Da.
    Residues 261 Isoelectric Point 9.04
    Sequence miiadnikqfhsirnslikqqkigfvptmgalhnghislikkaksendvvivsifvnptqfnnpndyqt ypnqlqqdiqilasldvdvlfnpsekdiypdgnllriepkleianilegksrpghfsgmltvvlkllqi tkpnnlylgekdyqqvmlikqlvkdffintkiivcptqrqpsglplssrnknltstdieiankiyeilr qddfsnleeltnkinstgaklqyiqklnnriflafyigkvrlidnflketgpsc
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.223
    Matthews' coefficent 2.38 Rfactor 0.179
    Waters 331 Solvent Content 48.39

    Ligand Information
    Ligands PRO (ADENOSINE) x 2;AMP (GLYCEROL) x 2;GOL (ACETIC) x 4;ACY x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch