.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n9i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of tryptophanyl-tRNA synthetase from Yersinia pestis CO92. TO BE PUBLISHED
    Site CSGID
    PDB Id 3n9i Target Id IDP90591
    Molecular Characteristics
    Source Yersinia pestis co92
    Alias Ids TPS48452,214092, 16120500 Molecular Weight 38667.17 Da.
    Residues 346 Isoelectric Point 5.84
    Sequence msepmvlskptvsskpivfsgaqpsgeltignymgalrqwvqmqddydciycivdlhaitarqdpallr krtldtlalylacgidpkkstifvqshvpehsqlswalncytyfgelsrmtqfkdksaryaeninaglf dypvlmaadillyqtnqvpvgedqkqhlelsrdiasrfnnlygdifkipepfipkagarvmslqdptkk msksddnrnnvielledpksvvkkikramtdsdepalirydvekkagvsnlldilsgvtgqsipeleaq ftgqmyghlkgavadavsgmlselqeryrtyredeallqdvmregaakararaqvtlakvyeaigfvaqp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.20615
    Matthews' coefficent 2.35 Rfactor 0.16707
    Waters 445 Solvent Content 47.57

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals CA (CALCIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch