.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nua

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Phosphoribosylaminoimidazole-Succinocarboxamide Synthase from Clostridium perfringens. To be Published
    Site CSGID
    PDB Id 3nua Target Id IDP04560
    Molecular Characteristics
    Source Clostridium perfringens atcc 13124
    Alias Ids TPS48437,195103, 110799762 Molecular Weight 27001.49 Da.
    Residues 235 Isoelectric Point 5.25
    Sequence mvnqlemlyegkakkiyatdkedmvivhykddatafngekkaqieskgvlnneitslifemlnkegikt hfveklndrdqlckkveivplevivrnvaagsmakrlgleegyelkttvfelsykddslgdplindyha vgigattfeelnkiyeitakvneilkeafkkqninlidfklefgryngeilladeispdtcrfwdattg ekmdkdrfrrdmgnvingyrevlnrlrn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.161
    Matthews' coefficent 2.50 Rfactor 0.143
    Waters 711 Solvent Content 50.76

    Ligand Information
    Ligands ADP (ADENOSINE-5'-DIPHOSPHATE) x 3;AMP (ADENOSINE) x 1;CIT (CITRIC) x 2;GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch